Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Matrix metalloproteinase-20 (Mmp20)

This Recombinant Mouse Matrix metalloproteinase-20 (Mmp20) spans the amino acid sequence from region 107-482aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMP-20; Enamel metalloproteinase; Enamelysin

UniProt

P57748

Expression Region

107-482aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YRLFPGEPKWKKNILTYRISKYTPSMSPTEVDKAIQMALHAWSTAVPLNFVRINSGEADIMISFETGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLGHSTDPSALMYPTYKYQNPYRFHLPKDDVKGIQALYGPRKIFPGKPTMPHIPPHKPSIPDLCDSSSSFDAVTMLGKELLFFKDRIFWRRQVHLPTGIRPSTITSSFPQLMSNVDAAYEVAERGIAFFFKGPHYWVTRGFHMQGPPRTIYDFGFPRHVQRIDAAVYLKEPQKTLFFVGEEYYSYDERKKKMEKDYPKNTEEEFSGVSGHIDAAVELNGYIYFFSGRKTFKYDTEKEDVVSVVKSSSWIGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atic Mouse Gene Knockout Kit (CRISPR)
KN501745 1 Kit

Atic Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SIN-1, 25x1mg
#00221-1 25x 1 mg

SIN-1, 25x1mg

Sign In for Pricing
View Details
Androstane Spin Label (ASL)
TRC-A637395-10MG 10 mg

Androstane Spin Label (ASL)

Sign In for Pricing
View Details
Screw-cap MicroCentrifuge Tubes
C3220-SG 1000 Units/Case

Screw-cap MicroCentrifuge Tubes

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF594 conjugate, 0.1mg/mL
BNC940902-100 1x 100 µL

Nucleolin (NCL/902), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details