Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus elongatus Circadian clock oscillator protein KaiB (kaiB)

This Recombinant Synechococcus elongatus Circadian clock oscillator protein KaiB (kaiB) spans the amino acid sequence from region 1-102aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q79PF5

Expression Region

1-102aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) (Anacystis nidulans R2)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPRKTYILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cytochrome c1 Antibody
CPA4382-01 30 µL

Anti-Cytochrome c1 Antibody

Sign In for Pricing
View Details
Anti-Cytochrome c1 Antibody
CPA4382-02 50 μL

Anti-Cytochrome c1 Antibody

Sign In for Pricing
View Details
Anti-Cytochrome c1 Antibody
CPA4382-03 100 µL

Anti-Cytochrome c1 Antibody

Sign In for Pricing
View Details
Anti-Cytochrome c1 Antibody
CPA4382-04 200 µL

Anti-Cytochrome c1 Antibody

Sign In for Pricing
View Details
CD3E (23-126aa) Monoclonal Antibody
E53M01158 100 µL

CD3E (23-126aa) Monoclonal Antibody

Sign In for Pricing
View Details
AMH Mouse Monoclonal Antibody
orb2563585-01 1 Each

AMH Mouse Monoclonal Antibody

Sign In for Pricing
View Details