Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Suppression of tumorigenicity 18 protein (ST18), partial

This Recombinant Human Suppression of tumorigenicity 18 protein (ST18), partial spans the amino acid sequence from region 120-260aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 387

UniProt

O60284

Expression Region

120-260aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SCYQELMVKSLMHLGKFEKNVSVQTVSENLNDSGIQSLKAESDEADECFLIHSDDGRDKIDDSQPPFCSSDDNESNSESAENGWDSGSNFSEETKPPRVPKYVLTDHKKDLLEVPEIKTEGDKFIPCENRCDSETERKDPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (phospho Thr17) Polyclonal Antibody
MBS9242456-01 0.1 mL

Histone H1 (phospho Thr17) Polyclonal Antibody

Sign In for Pricing
View Details
Histone H1 (phospho Thr17) Polyclonal Antibody
MBS9242456-02 5x 0.1 mL

Histone H1 (phospho Thr17) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal alpha 2-Macroglobulin Antibody (134) [Alexa Fluor 405]
NBP2-89720AF405 0.1 mL

Rabbit Monoclonal alpha 2-Macroglobulin Antibody (134) [Alexa Fluor 405]

Sign In for Pricing
View Details
IFNA10 sgRNA CRISPR Lentivector (Human) (Target 1)
K1019702 1.0 µg DNA

IFNA10 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human ALDH3A1 Knockout A549 cell line
GTR15409975 1 Vial

Human ALDH3A1 Knockout A549 cell line

Sign In for Pricing
View Details
Liver Arginase Rabbit mAb Antibody
orb1951935-01 50 µL

Liver Arginase Rabbit mAb Antibody

Sign In for Pricing
View Details