Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-P (S100P)

This Recombinant Human Protein S100-P (S100P) spans the amino acid sequence from region 1-95aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Migration-inducing gene 9 protein; MIG9; Protein S100-E; S100 calcium-binding protein P

UniProt

P25815

Expression Region

1-95aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD2 Rabbit Polyclonal Antibody
TA392666 100 µL

SMAD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HINT2 (NM_032593) Human Recombinant Protein
TP308371L 1 mg

HINT2 (NM_032593) Human Recombinant Protein

Sign In for Pricing
View Details
(E)-Dodec-2-enoic Acid Ethyl Ester
TRC-D525560-250MG 250 mg

(E)-Dodec-2-enoic Acid Ethyl Ester

Sign In for Pricing
View Details
LEFTY2 (NM_001172425) Human Over-expression Lysate
LY432898 100 µg

LEFTY2 (NM_001172425) Human Over-expression Lysate

Sign In for Pricing
View Details
EVI2B Mouse Monoclonal Antibody [Clone ID: MEM-216]
AM12138PU-N 100 µg

EVI2B Mouse Monoclonal Antibody [Clone ID: MEM-216]

Sign In for Pricing
View Details
CD86 (C86/1146), CF647 conjugate, 0.1mg/mL
BNC471146-100 1x 100 µL

CD86 (C86/1146), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details