Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-P (S100P)

This Recombinant Human Protein S100-P (S100P) spans the amino acid sequence from region 1-95aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Migration-inducing gene 9 protein; MIG9; Protein S100-E; S100 calcium-binding protein P

UniProt

P25815

Expression Region

1-95aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF488A conjugate, 0.1mg/mL
BNC882717-500 1x 500 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytoskeletal Marker Antibody Sampler Kit
HAK21084 1 Kit

Cytoskeletal Marker Antibody Sampler Kit

Sign In for Pricing
View Details
Recombinant Rift Valley fever virus (TAN/Dod-002/07) RVFV-L Protein (His Tag)
PKSV030247 100 µg

Recombinant Rift Valley fever virus (TAN/Dod-002/07) RVFV-L Protein (His Tag)

Sign In for Pricing
View Details
AF/LE Purified Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F097930-01 100 µg

AF/LE Purified Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
AF/LE Purified Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F097930-02 1 mg

AF/LE Purified Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
AF/LE Purified Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F097930-03 5 mg

AF/LE Purified Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details