Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dermatophagoides pteronyssinus Mite allergen Der p 3 (DERP3)

This Recombinant Dermatophagoides pteronyssinus Mite allergen Der p 3 (DERP3) spans the amino acid sequence from region 30-261aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Der p III; allergen Der p 3

UniProt

P39675

Expression Region

30-261aa

Tag

Tag-Free

Source

E.coli

Origin

Dermatophagoides pteronyssinus (European house dust mite)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGEKALAGECPYQISLQSSSHFCGGTILDEYWILTAAHCVAGQTASKLSIRYNSLKHSLGGEKISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAKGSDVKVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMICGGDVANGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYGCARKGYPGVYTRVGNFIDWIESKRSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD62L/SELL Antibody Picoband® (Dylight488 Conjugate)
PB9389-Dylight488 100 µg

Anti-CD62L/SELL Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
ADAP Peptide
4277P 0.05 mg

ADAP Peptide

Sign In for Pricing
View Details
GTF2H4 Antibody
28-777 100 µL

GTF2H4 Antibody

Sign In for Pricing
View Details
KIR2DS4/CD158i Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-2644R-APC-Cy5.5 100 µL

KIR2DS4/CD158i Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rat Amylase, Alpha 2A (AMY2A) ELISA Kit
EKU11696 96 Tests

Rat Amylase, Alpha 2A (AMY2A) ELISA Kit

Sign In for Pricing
View Details
(8-chlorodibenzo[b, d]furan-1-yl) boronic acid
JH915155 1 Each

(8-chlorodibenzo[b, d]furan-1-yl) boronic acid

Sign In for Pricing
View Details