Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Membrane-associated progesterone receptor component 2 (PGRMC2), Partial

This Recombinant Human Membrane-associated progesterone receptor component 2 (PGRMC2), Partial spans the amino acid sequence from region 67-223aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Progesterone membrane-binding protein; Steroid receptor protein DG6

UniProt

O15173

Expression Region

67-223aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGR5, NT (LGR5, GPR49, GPR67, Leucine-rich repeat-containing G-protein coupled receptor 5, G-protein coupled receptor 49, G-protein coupled receptor 67, G-protein coupled receptor HG38) (MaxLight 550) discontinued
037761-ML550 100 µL

LGR5, NT (LGR5, GPR49, GPR67, Leucine-rich repeat-containing G-protein coupled receptor 5, G-protein coupled receptor 49, G-protein coupled receptor 67, G-protein coupled receptor HG38) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Mobkl2b 3'UTR GFP Stable Cell Line
TU263294 1.0 mL

Mobkl2b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HDAC6 Rabbit Polyclonal Antibody (PerCP)
orb2434651 100 µL

HDAC6 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Mouse Mitd1 Pre-designed siRNA Set B
SI108506B 1 Each

Mouse Mitd1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Monoclonal CRACC/SLAMF7 Antibody (OTI1F1) [mFluor Violet 450 SE]
NBP2-72107MFV450 0.1 mL

Mouse Monoclonal CRACC/SLAMF7 Antibody (OTI1F1) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
CDCP1 Peptide
orb1234650 0.1 mg

CDCP1 Peptide

Sign In for Pricing
View Details