Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lysozyme C-1 (Lyz1)

This Recombinant Rat Lysozyme C-1 (Lyz1) spans the amino acid sequence from region 19-148aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1,4-beta-N-acetylmuramidase C

UniProt

P00697

Expression Region

19-148aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KIYERCQFARTLKRNGMSGYYGVSLADWVCLAQHESNYNTQARNYNPGDQSTDYGIFQINSRYWCNDGKTPRAKNACGIPCSALLQDDITQAIQCAKRVVRDPQGIRAWVAWQRHCKNRDLSGYIRNCGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diquafosol Sodium Salt (90%)
TRC-D492880-5MG 5 mg

Diquafosol Sodium Salt (90%)

Sign In for Pricing
View Details
AM 0902
TRC-A634660-2.5MG 2.5 mg

AM 0902

Sign In for Pricing
View Details
Tissue FFPE Sections, Appendix
CS802689 5x 5 µm

Tissue FFPE Sections, Appendix

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS619887 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3273), CF594 conjugate, 0.1mg/mL
BNC943273-100 1x 100 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3273), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SLC6A20 activation kit by CRISPRa
GA110228 1 Kit

Human SLC6A20 activation kit by CRISPRa

Sign In for Pricing
View Details