Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitofusin-2 (Mfn2), partial

This Recombinant Mouse Mitofusin-2 (Mfn2), partial spans the amino acid sequence from region 648-757aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hypertension-related protein 1; Mitochondrial assembly regulatory factor; HSG protein; Transmembrane GTPase MFN2

UniProt

Q80U63

Expression Region

648-757aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ERLTWTTKAKERAFKRQFVEYASEKLQLIISYTGSNCSHQVQQELSGTFAHLCQQVDITRDNLEQEIAAMNKKVEALDSLQSRAKLLRNKAGWLDSELNMFTHQYLQPSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BuChE-IN-11
HY-163746 1 Each

BuChE-IN-11

Sign In for Pricing
View Details
GABRB3 sgRNA CRISPR Lentivector (Human) (Target 1)
K0829702 1.0 µg DNA

GABRB3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Ctxn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3254208 1.0 µg DNA

Ctxn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
HPLM Base w/o Glycerol and Glucose (Powder)
H8100-03 50 L

HPLM Base w/o Glycerol and Glucose (Powder)

Sign In for Pricing
View Details
C11orf16 antibody
70R-9501 100 µL

C11orf16 antibody

Sign In for Pricing
View Details
Anti-TBG Antibody, Rabbit Polyclonal
MBS8104530-01 0.1 mL

Anti-TBG Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details