Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apis mellifera Allergen Api m 6.03 / Api m 6.04

This Recombinant Apis mellifera Allergen Api m 6.03 / Api m 6.04 spans the amino acid sequence from region 22-92aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Api m 6

UniProt

P83563

Expression Region

22-92aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Apis mellifera (Honeybee)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FGGFGGFGGLGGRGKCPSNEIFSRCDGRCQRFCPNVVPKPLCIKICAPGCVCRLGYLRNKKKVCVPRSKCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dusp3 (NM_028207) Mouse Tagged ORF Clone
MG201720 10 µg

Dusp3 (NM_028207) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD45 (PTPRC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D8]
TA506104AM 100 µL

CD45 (PTPRC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D8]

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS627448 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS642208 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD58 Antibody[TS2/9.1]
E-AB-F1068L-01 20 Tests

Elab Fluor® 488 Anti-Human CD58 Antibody[TS2/9.1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD58 Antibody[TS2/9.1]
E-AB-F1068L-02 100 Tests

Elab Fluor® 488 Anti-Human CD58 Antibody[TS2/9.1]

Sign In for Pricing
View Details