Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial

This Recombinant Human Butyrophilin-like protein 2 (BTNL2), partial spans the amino acid sequence from region 28-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BTL-II

UniProt

Q9UIR0

Expression Region

28-245aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF4 Goat Polyclonal Antibody
AP32964PU-N 100 µg

TCF4 Goat Polyclonal Antibody

Sign In for Pricing
View Details
THBS4 Antibody
8C19108-AAT 50 µg

THBS4 Antibody

Sign In for Pricing
View Details
TC 14012 TFA Salt
TRC-T012090-5MG 5 mg

TC 14012 TFA Salt

Sign In for Pricing
View Details
Benzovindiflupyr-D3
TRC-B525971-25MG 25 mg

Benzovindiflupyr-D3

Sign In for Pricing
View Details
Mouse Svs6 activation kit by CRISPRa
GA204174 1 Kit

Mouse Svs6 activation kit by CRISPRa

Sign In for Pricing
View Details
LILRB2 (NM_001080978) Human Over-expression Lysate
LC421144 20 µg

LILRB2 (NM_001080978) Human Over-expression Lysate

Sign In for Pricing
View Details