Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gamma-synuclein (Sncg)

This Recombinant Mouse Gamma-synuclein (Sncg) spans the amino acid sequence from region 1-123aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Persyn

UniProt

Q9Z0F7

Expression Region

1-123aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEEAKSGED

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z 300
T35288 25 mg

Z 300

Sign In for Pricing
View Details
IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)
35R-0036 100 ug

IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)

Sign In for Pricing
View Details
IRF2BP2 Antibody
MBS151577-01 0.1 mg

IRF2BP2 Antibody

Sign In for Pricing
View Details
IRF2BP2 Antibody
MBS151577-02 5x 0.1 mg

IRF2BP2 Antibody

Sign In for Pricing
View Details
Puromycin
MBS5756288 Inquire

Puromycin

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae ATP synthase subunit a (atpB)
MBS7008747-01 0.02 mg

Recombinant Haemophilus influenzae ATP synthase subunit a (atpB)

Sign In for Pricing
View Details