Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human L-lactate dehydrogenase A chain (LDHA)

This Recombinant Human L-lactate dehydrogenase A chain (LDHA) spans the amino acid sequence from region 2-332aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LDH-A; Cell proliferation-inducing gene 19 protein; LDH muscle subunit; LDH-M; Renal carcinoma antigen NY-REN-59

UniProt

P00338

Expression Region

2-332aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Oxo-3,4-dihydroquinazoline-7-carboxylic Acid (Ammonium Salt)
TRC-O991660-500MG 500 mg

4-Oxo-3,4-dihydroquinazoline-7-carboxylic Acid (Ammonium Salt)

Sign In for Pricing
View Details
Chmp2b (NM_026879) Mouse Tagged ORF Clone
MG202330 10 µg

Chmp2b (NM_026879) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
1-Fluoronaphthalene
TRC-F593760-5G 5 g

1-Fluoronaphthalene

Sign In for Pricing
View Details
PRPSAP1 (NM_002766) Human Over-expression Lysate
LY432208 100 µg

PRPSAP1 (NM_002766) Human Over-expression Lysate

Sign In for Pricing
View Details
Topoisomerase I, MT (TOP1MT/488), CF405S conjugate, 0.1mg/mL
BNC040488-100 1x 100 µL

Topoisomerase I, MT (TOP1MT/488), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acid Phosphatase (ACP1) (N-term) Rabbit Polyclonal Antibody
AP50056PU-N 400 µL

Acid Phosphatase (ACP1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details