Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein phosphatase PGAM5, mitochondrial (PGAM5), partial

This Recombinant Human Serine/threonine-protein phosphatase PGAM5, mitochondrial (PGAM5), partial spans the amino acid sequence from region 30-289aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bcl-XL-binding protein v68; Phosphoglycerate mutase family member 5

UniProt

Q96HS1

Expression Region

30-289aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLM Polyclonal Antibody
RA22418-01 50 µL

BLM Polyclonal Antibody

Sign In for Pricing
View Details
BLM Polyclonal Antibody
RA22418-02 100 µL

BLM Polyclonal Antibody

Sign In for Pricing
View Details
Human ADRB1 Antibody , APC
E55A08181 50 Tests

Human ADRB1 Antibody , APC

Sign In for Pricing
View Details
LRRTM1 Mouse Monoclonal Antibody [Clone ID: OTI1C5]
TA805446 100 µL

LRRTM1 Mouse Monoclonal Antibody [Clone ID: OTI1C5]

Sign In for Pricing
View Details
Uqcrq sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6635806 1.0 µg DNA

Uqcrq sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
BD2 (beta Defensin-2, beta 2 Defensin, Defensin beta 2, BD 2, BD-2, DEFB2, DEFB-2, HBD 2, HBD2, HBD-2, DEFB102, Skin Antimicrobial Peptide 1, SAP1) (FITC)
MBS6465167-01 0.1 mL

BD2 (beta Defensin-2, beta 2 Defensin, Defensin beta 2, BD 2, BD-2, DEFB2, DEFB-2, HBD 2, HBD2, HBD-2, DEFB102, Skin Antimicrobial Peptide 1, SAP1) (FITC)

Sign In for Pricing
View Details