Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse XIAP-associated factor 1 (Xaf1)

This Recombinant Mouse XIAP-associated factor 1 (Xaf1) spans the amino acid sequence from region 1-273aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BIRC4-binding protein

UniProt

Q5NBU8

Expression Region

1-273aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEADFQVCRNCKRNVASLHFMLHEAHCLRFIVLCPECEEPIPESKMKEHMEVVHQQTKESQQHPAKCKFCELAVQLSNLDVHESHCGSRTEHCPHCNQPITLQVLSQHKAMCLSAKGRPEEGKRIVSSPGRKTRCDLCKQMIPENTYASHMKQCSAPNTVTRIRDESIIVIPSTLAFMDSGNRRSTVSKDVRPKTKNRNSSTKRETKKQNGTVALPLKSGLQQRADLPTGDETAYDTLQNCCQCRILLPLPILNEHQEKCQRLAHQKKLQWGW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal uPAR Antibody (014) [DyLight 488]
NBP2-90454G 0.1 mL

Rabbit Monoclonal uPAR Antibody (014) [DyLight 488]

Sign In for Pricing
View Details
FEZ2 Protein Vector (Rat) (pPM-C-HA)
20468026 500 ng

FEZ2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Cyp24a1 ORF Vector (Mouse) (pORF)
17326014 1.0 µg DNA

Cyp24a1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CLACP (COL25A1) Rabbit Polyclonal Antibody
TA312548 100 µL

CLACP (COL25A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human NRP2 Antibody (SAA1517)
MBS1570477-01 0.1 mg

Anti-Human NRP2 Antibody (SAA1517)

Sign In for Pricing
View Details
Anti-Human NRP2 Antibody (SAA1517)
MBS1570477-02 1 mg

Anti-Human NRP2 Antibody (SAA1517)

Sign In for Pricing
View Details