Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Hemoglobin subunit alpha-A/Q/R/T

This Recombinant Macaca fascicularis Hemoglobin subunit alpha-A/Q/R/T spans the amino acid sequence from region 1-141aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-A/Q/R/T-globin; Hemoglobin alpha-A/Q/R/T chain

UniProt

P21767

Expression Region

1-141aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Complement C5
E1969h 96 Tests

ELISA Kit For Complement C5

Sign In for Pricing
View Details
CNOX Recombinant Protein Antigen
NBP1-88152PEP 0.1 mL

CNOX Recombinant Protein Antigen

Sign In for Pricing
View Details
BTG1 Recombinant Protein (Human)
RP003268 100 µg

BTG1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Chicken Serine Dehydratase
GTR10370763 96 Well

Chicken Serine Dehydratase

Sign In for Pricing
View Details
Recombinant Human LAMTOR4 Protein, N-His
HB384012-01 50 µg

Recombinant Human LAMTOR4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human LAMTOR4 Protein, N-His
HB384012-02 100 µg

Recombinant Human LAMTOR4 Protein, N-His

Sign In for Pricing
View Details