Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor receptor type 1-associated DEATH domain protein (Tradd)

This Recombinant Mouse Tumor necrosis factor receptor type 1-associated DEATH domain protein (Tradd) spans the amino acid sequence from region 1-310aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TNFR1-associated DEATH domain protein; TNFRSF1A-associated via death domain

UniProt

Q3U0V2

Expression Region

1-310aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Immunology & Inflammation; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRAGAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGSKFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCRALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPDGGLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EIF4A1 Antibody Picoband® (monoclonal, 3F11), Carrier-free
M03922-2-carrier-free 100 µg/Vial

Anti-EIF4A1 Antibody Picoband® (monoclonal, 3F11), Carrier-free

Sign In for Pricing
View Details
1- (Cyclopropylmethoxy) -4-fluoro-2-nitrobenzene
STB49628-01 250 mg

1- (Cyclopropylmethoxy) -4-fluoro-2-nitrobenzene

Sign In for Pricing
View Details
1- (Cyclopropylmethoxy) -4-fluoro-2-nitrobenzene
STB49628-02 2.5 g

1- (Cyclopropylmethoxy) -4-fluoro-2-nitrobenzene

Sign In for Pricing
View Details
RhoGAP (ARHGAP5) Human qPCR Primer Pair (NM_001030055)
HP202866 200 Reactions

RhoGAP (ARHGAP5) Human qPCR Primer Pair (NM_001030055)

Sign In for Pricing
View Details
Human ARID3B Knockout A549 cell line
GTR15419273 1 Vial

Human ARID3B Knockout A549 cell line

Sign In for Pricing
View Details
HDAC3 Antibody
RQ4727 100 µL

HDAC3 Antibody

Sign In for Pricing
View Details