Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Feline coronavirus Spike glycoprotein (S), Partial

This Recombinant Feline coronavirus Spike glycoprotein (S), Partial spans the amino acid sequence from region 561-804aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S glycoprotein; E2; Peplomer protein

UniProt

P10033

Expression Region

561-804aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Feline coronavirus (strain FIPV WSU-79/1146) (FCoV)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PMQDNNTDVYCIRSNQFSVYVHSTCKSSLWDNIFNQDCTDVLEATAVIKTGTCPFSFDKLNNYLTFNKFCLSLSPVGANCKFDVAARTRTNEQVVRSLYVIYEEGDNIVGVPSDNSGLHDLSVLHLDSCTDYNIYGRTGVGIIRRTNSTLLSGLYYTSLSGDLLGFKNVSDGVIYSVTPCDVSAQAAVIDGAIVGAMTSINSELLGLTHWTTTPNFYYYSIYNYTSERTRGTAIDSNDVDCEPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-Cetirizine Dihydrochloride
TRC-C281105-2.5MG 2.5 mg

(S)-Cetirizine Dihydrochloride

Sign In for Pricing
View Details
2-Thiopheneacetic Acid
TRC-T344795-1G 1 g

2-Thiopheneacetic Acid

Sign In for Pricing
View Details
X-GAL, 5 g
#10011-2 1x 5 g

X-GAL, 5 g

Sign In for Pricing
View Details
MAPT / TAU pSer235 Rabbit Polyclonal Antibody
AP02398PU-S 50 µL

MAPT / TAU pSer235 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HIS Lite™ OG488-Tris NTA-Ni Complex
12615-AAT 100 µg

HIS Lite™ OG488-Tris NTA-Ni Complex

Sign In for Pricing
View Details
Nuclei Mouse Monoclonal Antibody [Clone ID: 235-1]
AM08257SU-N 100 µL

Nuclei Mouse Monoclonal Antibody [Clone ID: 235-1]

Sign In for Pricing
View Details