Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interleukin-3 (IL3)

This Recombinant Bovine Interleukin-3 (IL3) spans the amino acid sequence from region 18-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor

UniProt

P49875

Expression Region

18-144aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APQAKGLPVVTSRTPYSMLMKEIMDDLKKITPSPEGSLNSDEKNFLTKESLLQANLKVFMTFATDTFGSDSKIMKNLKEFQPVLPTATPTEDPIFIENKNLGDFRMKLEEYLVIIRNYLKSKNIWFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human JAGN1 activation kit by CRISPRa
GA113580 1 Kit

Human JAGN1 activation kit by CRISPRa

Sign In for Pricing
View Details
Bspry Mouse Gene Knockout Kit (CRISPR)
KN502287 1 Kit

Bspry Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-AcO-DET Fumarate
TRC-A190270-5MG 5 mg

4-AcO-DET Fumarate

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3241), 0.2mg/mL
BNUB3241-100 1x 100 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3241), 0.2mg/mL

Sign In for Pricing
View Details
Cefoperazone Sodium Salt
TRC-C242900-5G 5 g

Cefoperazone Sodium Salt

Sign In for Pricing
View Details
Human NEFL (Neurofilament, Light Polypeptide) CLIA Kit
E-CL-H0536-01 24 Tests

Human NEFL (Neurofilament, Light Polypeptide) CLIA Kit

Sign In for Pricing
View Details