Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Profilin-1 (PRO1)

This Recombinant Zea mays Profilin-1 (PRO1) spans the amino acid sequence from region 2-131aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pollen allergen Zea m 12; ZmPRO1; allergen Zea m 12

UniProt

P35081

Expression Region

2-131aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Zea mays (Maize)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVERLGDYLLEQGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFB135 Human Gene Knockout Kit (CRISPR)
KN424423 1 Kit

DEFB135 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DPH2 (NM_001384) Human Over-expression Lysate
LC419990 20 µg

DPH2 (NM_001384) Human Over-expression Lysate

Sign In for Pricing
View Details
Butyrylcholinesterase (BCHE) Rabbit Polyclonal Antibody
AP14658PU-N 400 µL

Butyrylcholinesterase (BCHE) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTM1 Human Gene Knockout Kit (CRISPR)
KN205306BN 1 Kit

MTM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CoREST (RCOR1) Mouse Monoclonal Antibody [Clone ID: OTI9F6]
CF813008 100 µg

CoREST (RCOR1) Mouse Monoclonal Antibody [Clone ID: OTI9F6]

Sign In for Pricing
View Details
NRBF2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F3]
TA804085AM 100 µL

NRBF2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F3]

Sign In for Pricing
View Details