Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Complement C1q and TNF related 3 (C1qtnf3)

This Recombinant Rat Complement C1q and TNF related 3 (C1qtnf3) spans the amino acid sequence from region 23-319aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

B1WC91

Expression Region

23-319aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDEYMEVSRRANKAVARIVQSHQQTGRSGSRREKVREQSHAKTGTVDNNTSTDLKSLRPDELPHPEVEDLAQINPFWGQSPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETHE1 Antibody
MBS7125553-01 0.05 mL

ETHE1 Antibody

Sign In for Pricing
View Details
ETHE1 Antibody
MBS7125553-02 0.1 mL

ETHE1 Antibody

Sign In for Pricing
View Details
ETHE1 Antibody
MBS7125553-03 5x 0.1 mL

ETHE1 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Pkia shRNA (UAS) - Lentiviral mouse Pkia shRNA (UAS, RFP) (100)
GTR15175944 1 Vial

Lentiviral mouse Pkia shRNA (UAS) - Lentiviral mouse Pkia shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
L-Tyrosine, USP grade, non-animal origin
GM1911-1kg 1 Kg

L-Tyrosine, USP grade, non-animal origin

Sign In for Pricing
View Details
SLC38A10 Peptide - C-terminal region (AAP44855)
AAP44855-100UG 100 µg

SLC38A10 Peptide - C-terminal region (AAP44855)

Sign In for Pricing
View Details