Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Complement C1q and TNF related 3 (C1qtnf3)

This Recombinant Rat Complement C1q and TNF related 3 (C1qtnf3) spans the amino acid sequence from region 23-319aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

B1WC91

Expression Region

23-319aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDEYMEVSRRANKAVARIVQSHQQTGRSGSRREKVREQSHAKTGTVDNNTSTDLKSLRPDELPHPEVEDLAQINPFWGQSPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal CCL21/6Ckine Antibody (RM0174-10K10) [DyLight 650]
NBP2-12104C 0.1 mL

Rat Monoclonal CCL21/6Ckine Antibody (RM0174-10K10) [DyLight 650]

Sign In for Pricing
View Details
METTL23 (NM_001302705) Human Tagged ORF Clone
RG236395 10 µg

METTL23 (NM_001302705) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Anti GOLIM4 Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA)
IRBAMLGOLIM4AAP922120UL 1 Each

Rabbit Anti GOLIM4 Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA)

Sign In for Pricing
View Details
Horse Prokineticin Receptor 1 ELISA Kit
MBS031867-01 48 Well

Horse Prokineticin Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Horse Prokineticin Receptor 1 ELISA Kit
MBS031867-02 96 Well

Horse Prokineticin Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Horse Prokineticin Receptor 1 ELISA Kit
MBS031867-03 5x 96 Well

Horse Prokineticin Receptor 1 ELISA Kit

Sign In for Pricing
View Details