Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cystatin-12 (Cst12)

This Recombinant Mouse Cystatin-12 (Cst12) spans the amino acid sequence from region 22-128aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin TE-1

UniProt

Q9DAN8

Expression Region

22-128aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KFLEIDKNEEEFAISVEHVVFHFNENQDDDFAYKFLRVRRSLRQKYTLKYLVDLEMGRTLCGKYDEDIDNCPLQEGPGERKVRCTYIVETEAWVTKFTILNSTCVQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM16L (NM_001037330) Human Tagged Lenti ORF Clone
RC214981L3 10 µg

TRIM16L (NM_001037330) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Dhrs3-set siRNA/shRNA/RNAi Lentivector (Rat)
18184096 4x 500 ng

Dhrs3-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
EDF1 siRNA (Human)
MBS8240215-01 15 nmol

EDF1 siRNA (Human)

Sign In for Pricing
View Details
EDF1 siRNA (Human)
MBS8240215-02 30 nmol

EDF1 siRNA (Human)

Sign In for Pricing
View Details
EDF1 siRNA (Human)
MBS8240215-03 5x 30 nmol

EDF1 siRNA (Human)

Sign In for Pricing
View Details
Dichloroisocyanuric acid sodium salt dihydrate
JH319379 1 Each

Dichloroisocyanuric acid sodium salt dihydrate

Sign In for Pricing
View Details