Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cystatin-12 (Cst12)

This Recombinant Mouse Cystatin-12 (Cst12) spans the amino acid sequence from region 22-128aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin TE-1

UniProt

Q9DAN8

Expression Region

22-128aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KFLEIDKNEEEFAISVEHVVFHFNENQDDDFAYKFLRVRRSLRQKYTLKYLVDLEMGRTLCGKYDEDIDNCPLQEGPGERKVRCTYIVETEAWVTKFTILNSTCVQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRDL2 Antibody - N-terminal region : HRP (ARP66005_P050-HRP)
ARP66005_P050-HRP 100 µL

CHRDL2 Antibody - N-terminal region : HRP (ARP66005_P050-HRP)

Sign In for Pricing
View Details
GSTT1 Polyclonal Antibody HRP Conjugated
orb1540954 100 µL

GSTT1 Polyclonal Antibody HRP Conjugated

Sign In for Pricing
View Details
4-Chloro-6- (N, N-diethylamino) pyrimidine
sc-323087 1 g

4-Chloro-6- (N, N-diethylamino) pyrimidine

Sign In for Pricing
View Details
ZFP40 HDR Plasmid (m)
sc-423785-HDR 20 µg

ZFP40 HDR Plasmid (m)

Sign In for Pricing
View Details
TMEM177 Conjugated Antibody
orb1612405 100 µL

TMEM177 Conjugated Antibody

Sign In for Pricing
View Details
Rat Anti-Mouse CD5 mAb (PE/Cy5)
orb2709902 100 Tests

Rat Anti-Mouse CD5 mAb (PE/Cy5)

Sign In for Pricing
View Details