Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cystatin-12 (Cst12)

This Recombinant Mouse Cystatin-12 (Cst12) spans the amino acid sequence from region 22-128aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cystatin TE-1

UniProt

Q9DAN8

Expression Region

22-128aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KFLEIDKNEEEFAISVEHVVFHFNENQDDDFAYKFLRVRRSLRQKYTLKYLVDLEMGRTLCGKYDEDIDNCPLQEGPGERKVRCTYIVETEAWVTKFTILNSTCVQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-CMV-Shisa4-3×FLAG-CopGFP-Puro Plasmid
PVT47123 2 µg

pLV3-CMV-Shisa4-3×FLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
CAV3 (Caveolin 3, LGMD1C, LQT9, MGC126100, MGC126101, MGC126129, VIP-21, VIP21)
244249 100 µg

CAV3 (Caveolin 3, LGMD1C, LQT9, MGC126100, MGC126101, MGC126129, VIP-21, VIP21)

Sign In for Pricing
View Details
Kifc1 Rat shRNA Plasmid (Locus ID 294286)
TR700686 1 Kit

Kifc1 Rat shRNA Plasmid (Locus ID 294286)

Sign In for Pricing
View Details
Anti-Mouse LRPAP1 Polyclonal Antibody
MB705014-01 50 µg

Anti-Mouse LRPAP1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse LRPAP1 Polyclonal Antibody
MB705014-02 100 µg

Anti-Mouse LRPAP1 Polyclonal Antibody

Sign In for Pricing
View Details
SF3A3 Rabbit Polyclonal Antibody
54862-01 50 µL

SF3A3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details