Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NELL2-interacting cell ontogeny regulator 1 (Nicol1)

This Recombinant Mouse NELL2-interacting cell ontogeny regulator 1 (Nicol1) spans the amino acid sequence from region 29-90aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q3UR78

Expression Region

29-90aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPATGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTETLLLQAERRALCACWPAGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAZF1 Rabbit Polyclonal Antibody
TA372813 100 µL

JAZF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF594 conjugate, 0.1mg/mL
BNC941118-100 1x 100 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF405S conjugate, 0.1mg/mL
BNC043291-500 1x 500 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apolipoprotein D (APOD) Human Gene Knockout Kit (CRISPR)
KN400503 1 Kit

Apolipoprotein D (APOD) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human MKK6 Protein (His & GST Tag)
PKSH030415 50 µg

Recombinant Human MKK6 Protein (His & GST Tag)

Sign In for Pricing
View Details
Recombinant BAF60C Monoclonal Antibody
AN301723L-01 50 µL

Recombinant BAF60C Monoclonal Antibody

Sign In for Pricing
View Details