Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NELL2-interacting cell ontogeny regulator 1 (Nicol1)

This Recombinant Mouse NELL2-interacting cell ontogeny regulator 1 (Nicol1) spans the amino acid sequence from region 29-90aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q3UR78

Expression Region

29-90aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPATGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTETLLLQAERRALCACWPAGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), 0.2mg/mL
BNUB1577-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), 0.2mg/mL

Sign In for Pricing
View Details
Human FBXL13 activation kit by CRISPRa
GA116663 1 Kit

Human FBXL13 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Rat CD10/Neprilysin Protein (His Tag)
PKSR030257 50 µg

Recombinant Rat CD10/Neprilysin Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS505158 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
FAM229B (NM_001033564) Human Over-expression Lysate
LY422392 100 µg

FAM229B (NM_001033564) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant MCM4 Antibody
RC-16191-01 50 μL

Recombinant MCM4 Antibody

Sign In for Pricing
View Details