Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NELL2-interacting cell ontogeny regulator 1 (Nicol1)

This Recombinant Mouse NELL2-interacting cell ontogeny regulator 1 (Nicol1) spans the amino acid sequence from region 29-90aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q3UR78

Expression Region

29-90aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPATGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTETLLLQAERRALCACWPAGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF740 conjugate, 0.1mg/mL
BNC741919-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Milk Fat Globulin (EDM45), CF594 conjugate, 0.1mg/mL
BNC940942-500 1x 500 µL

Milk Fat Globulin (EDM45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2966), CF594 conjugate, 0.1mg/mL
BNC942966-500 1x 500 µL

C1QB / Complement C1q B-Chain (C1QB/2966), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (CALNA/2353), CF640R conjugate, 0.1mg/mL
BNC402353-100 1x 100 µL

Calcineurin A / PPP3CA (CALNA/2353), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L-Aspartyl-L-phenylalanine Hydrochloride
TRC-A790010-1G 1 g

L-Aspartyl-L-phenylalanine Hydrochloride

Sign In for Pricing
View Details
CD89 (FCAR) (Center) Rabbit Polyclonal Antibody
AP51639PU-N 400 µL

CD89 (FCAR) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details