Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisome proliferator-activated receptor delta (PPARD), partial

This Recombinant Human Peroxisome proliferator-activated receptor delta (PPARD), partial spans the amino acid sequence from region 165-441aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PPAR-delta; NUCI; Nuclear hormone receptor 1; NUC1; Nuclear receptor subfamily 1 group C member 2; Peroxisome proliferator-activated receptor beta; PPAR-beta

UniProt

Q03181

Expression Region

165-441aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcineurin A (PPP3CA) Mouse Monoclonal Antibody [Clone ID: OTI5C6]
CF810584 100 µg

Calcineurin A (PPP3CA) Mouse Monoclonal Antibody [Clone ID: OTI5C6]

Sign In for Pricing
View Details
Canine Cholecystokinin (CCK) ELISA Kit
RD-CCK-c-01 96 Tests

Canine Cholecystokinin (CCK) ELISA Kit

Sign In for Pricing
View Details
Canine Cholecystokinin (CCK) ELISA Kit
RD-CCK-c-02 48 Tests

Canine Cholecystokinin (CCK) ELISA Kit

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2744), CF568 conjugate, 0.1mg/mL
BNC682744-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2744), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), 0.2mg/mL
BNUB1867-100 1x 100 µL

CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), 0.2mg/mL

Sign In for Pricing
View Details
Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), Biotin conjugate, 0.1mg/mL
BNCB2434-500 1x 500 µL

Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details