Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxisome proliferator-activated receptor delta (PPARD), partial

This Recombinant Human Peroxisome proliferator-activated receptor delta (PPARD), partial spans the amino acid sequence from region 165-441aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PPAR-delta; NUCI; Nuclear hormone receptor 1; NUC1; Nuclear receptor subfamily 1 group C member 2; Peroxisome proliferator-activated receptor beta; PPAR-beta

UniProt

Q03181

Expression Region

165-441aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SNCA (exidavnemab biosimilar) mAb
12-90147-50 50 µg

Anti-SNCA (exidavnemab biosimilar) mAb

Sign In for Pricing
View Details
Cytokeratin 19 KRT19 Mouse Monoclonal Antibody (PE)
orb2611697 100 µg

Cytokeratin 19 KRT19 Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Rabbit Anti-CYTSA/SPECC1L Polyclonal Antibody
PAV1096 100 μL

Rabbit Anti-CYTSA/SPECC1L Polyclonal Antibody

Sign In for Pricing
View Details
HypoTherrnoso FRS
101373 1x 10 mL - Vial

HypoTherrnoso FRS

Sign In for Pricing
View Details
Gitoxigenin
RG-G025101-01 10 mg

Gitoxigenin

Sign In for Pricing
View Details
Gitoxigenin
RG-G025101-02 25 mg

Gitoxigenin

Sign In for Pricing
View Details