Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Peptide YY-like (PYY)

This Recombinant Chicken Peptide YY-like (PYY) spans the amino acid sequence from region 1-37aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PYY

UniProt

P29203

Expression Region

1-37aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYPPKPESPGDAASPEEIAQYFSALRHYINLVTRQRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-500 1x 500 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(R)-Viloxazine Hydrochloride
TRC-V312450-50MG 50 mg

(R)-Viloxazine Hydrochloride

Sign In for Pricing
View Details
TrkA Recombinant Rabbit monoclonal Antibody [SU0354]
ET1608-44-50UL 50 µL

TrkA Recombinant Rabbit monoclonal Antibody [SU0354]

Sign In for Pricing
View Details
ketohexokinase (KHK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C3]
TA501328AM 100 µL

ketohexokinase (KHK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C3]

Sign In for Pricing
View Details
ZNF313 (RNF114) Rabbit Polyclonal Antibody
TA369654 100 µL

ZNF313 (RNF114) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse IL-2 Recombinant Rabbit Monoclonal Antibody [PSH04-28] - BSA and Azide free (Detector)
HA722111 100 µL

Mouse IL-2 Recombinant Rabbit Monoclonal Antibody [PSH04-28] - BSA and Azide free (Detector)

Sign In for Pricing
View Details