Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Peptide YY-like (PYY)

This Recombinant Chicken Peptide YY-like (PYY) spans the amino acid sequence from region 1-37aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PYY

UniProt

P29203

Expression Region

1-37aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYPPKPESPGDAASPEEIAQYFSALRHYINLVTRQRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCARB1 (NM_005505) Human Over-expression Lysate
LY401684 100 µg

SCARB1 (NM_005505) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: right
CB505633 1 Block

Frozen Tissue Blocks, Ovary: right

Sign In for Pricing
View Details
Uroplakin Ia (UPK1A) (C-term) Rabbit Polyclonal Antibody
AP54475PU-N 400 µL

Uroplakin Ia (UPK1A) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ST3GAL5 (NM_003896) Human Over-expression Lysate
LC401284 20 µg

ST3GAL5 (NM_003896) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Crotonyl Lysine Antibody
KC-2328-01 50 μL

Anti-Crotonyl Lysine Antibody

Sign In for Pricing
View Details
Anti-Crotonyl Lysine Antibody
KC-2328-02 100 µL

Anti-Crotonyl Lysine Antibody

Sign In for Pricing
View Details