Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6E (Ly6e)

This Recombinant Mouse Lymphocyte antigen 6E (Ly6e) spans the amino acid sequence from region 27-108aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-6E; Stem cell antigen 2; Thymic shared antigen 1; TSA-1

UniProt

Q64253

Expression Region

27-108aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR31 Antibody - middle region
ARP71985_P050-25UL 25 µL

WDR31 Antibody - middle region

Sign In for Pricing
View Details
Benzoic Anhydride 98% For Synthesis
00380 00100 100 g

Benzoic Anhydride 98% For Synthesis

Sign In for Pricing
View Details
Lentiviral mouse Fgf10 shRNA (UAS) - Lentiviral mouse Fgf10 shRNA (UAS) (25)
GTR15208661 1 Vial

Lentiviral mouse Fgf10 shRNA (UAS) - Lentiviral mouse Fgf10 shRNA (UAS) (25)

Sign In for Pricing
View Details
Riboflavin-binding protein Antibody
A51559-50UG 50 µg

Riboflavin-binding protein Antibody

Sign In for Pricing
View Details
Human Transient Receptor Potential Cation Channel Subfamily V (Member 1 (TRPV1) ELISA Kit
QY-E00110 96 Tests

Human Transient Receptor Potential Cation Channel Subfamily V (Member 1 (TRPV1) ELISA Kit

Sign In for Pricing
View Details
XFD594 Anti-human/monkey CD20 Antibody *2H7*
10202160-AAT 100 Tests

XFD594 Anti-human/monkey CD20 Antibody *2H7*

Sign In for Pricing
View Details