Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human YTH domain-containing family protein 1 (YTHDF1), partial

This Recombinant Human YTH domain-containing family protein 1 (YTHDF1), partial spans the amino acid sequence from region 389-523aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DF1; Dermatomyositis associated with cancer putative autoantigen 1; DACA-1

UniProt

Q9BYJ9

Expression Region

389-523aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NOBOX activation kit by CRISPRa
GA115259 1 Kit

Human NOBOX activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Cartilage Oligomeric Matrix Protein (COMP) ELISA Kit
RD-COMP-Mu-01 96 Tests

Mouse Cartilage Oligomeric Matrix Protein (COMP) ELISA Kit

Sign In for Pricing
View Details
Mouse Cartilage Oligomeric Matrix Protein (COMP) ELISA Kit
RD-COMP-Mu-02 48 Tests

Mouse Cartilage Oligomeric Matrix Protein (COMP) ELISA Kit

Sign In for Pricing
View Details
Recombinant AGPS Antibody
RC-4425-01 50 μL

Recombinant AGPS Antibody

Sign In for Pricing
View Details
Recombinant AGPS Antibody
RC-4425-02 100 µL

Recombinant AGPS Antibody

Sign In for Pricing
View Details
Recombinant AGPS Antibody
RC-4425-03 1 mL

Recombinant AGPS Antibody

Sign In for Pricing
View Details