Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cyclin-dependent kinase 9 (Cdk9)

This Recombinant Mouse Cyclin-dependent kinase 9 (Cdk9) spans the amino acid sequence from region 1-372aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell division protein kinase 9

UniProt

Q99J95

Expression Region

1-372aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKQYDSVECPFCDEVTKYEKLAKIGQGTFGEVFKAKHRQTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDKYELFEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oct-6 (B-7) X
sc-376143 X 200 µg - 0.1 mL

Oct-6 (B-7) X

Sign In for Pricing
View Details
C5aR1 antagonist peptide
MBS5824447 Inquire

C5aR1 antagonist peptide

Sign In for Pricing
View Details
FAM86C1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV761024 1.0 µg DNA

FAM86C1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
IRS Polyclonal Antibody
41076-01 50 µL

IRS Polyclonal Antibody

Sign In for Pricing
View Details
IRS Polyclonal Antibody
41076-02 100 µL

IRS Polyclonal Antibody

Sign In for Pricing
View Details
Latexin, ID (LXN, Latexin, Endogenous carboxypeptidase inhibitor, Protein MUM, Tissue carboxypeptidase inhibitor) (AP) discontinued
037690-AP 200 µL

Latexin, ID (LXN, Latexin, Endogenous carboxypeptidase inhibitor, Protein MUM, Tissue carboxypeptidase inhibitor) (AP) discontinued

Sign In for Pricing
View Details