Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Thioredoxin reductase 1, mitochondrial (Trxr1), partial

This Recombinant Drosophila melanogaster Thioredoxin reductase 1, mitochondrial (Trxr1), partial spans the amino acid sequence from region 111-588aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TrxR-1

UniProt

P91938

Expression Region

111-588aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RelB Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62968R-BF594-TR 20 µL

RelB Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
pCMV-SPORT6-Nsf Plasmid
PVT43464 2 µg

pCMV-SPORT6-Nsf Plasmid

Sign In for Pricing
View Details
CD45/LCA (B-Cell Marker)
MBS4380193-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

CD45/LCA (B-Cell Marker)

Sign In for Pricing
View Details
CD45/LCA (B-Cell Marker)
MBS4380193-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD45/LCA (B-Cell Marker)

Sign In for Pricing
View Details
CD45/LCA (B-Cell Marker)
MBS4380193-03 0.1 mg (Without BSA & Azide at 1mg/mL)

CD45/LCA (B-Cell Marker)

Sign In for Pricing
View Details
CD45/LCA (B-Cell Marker)
MBS4380193-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD45/LCA (B-Cell Marker)

Sign In for Pricing
View Details