Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6E (LY6E)

This Recombinant Human Lymphocyte antigen 6E (LY6E) spans the amino acid sequence from region 21-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-6E; Retinoic acid-induced gene E protein; RIG-E; Stem cell antigen 2; SCA-2; Thymic shared antigen 1; TSA-1

UniProt

Q16553

Expression Region

21-101aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM98B Rabbit mAb
orb1564919-01 20 ul

FAM98B Rabbit mAb

Sign In for Pricing
View Details
FAM98B Rabbit mAb
orb1564919-02 50 µL

FAM98B Rabbit mAb

Sign In for Pricing
View Details
FAM98B Rabbit mAb
orb1564919-03 100 µL

FAM98B Rabbit mAb

Sign In for Pricing
View Details
ACTL7B shRNA (h) Lentiviral Particles
sc-92677-V 200 µL

ACTL7B shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Meconin
MBS6068943-01 25 mg

Meconin

Sign In for Pricing
View Details
Meconin
MBS6068943-02 5x 25 mg

Meconin

Sign In for Pricing
View Details