Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 14 (FGF14)

This Recombinant Human Fibroblast growth factor 14 (FGF14) spans the amino acid sequence from region 1-252aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-14; Fibroblast growth factor homologous factor 4; FHF-4

UniProt

Q92915

Expression Region

1-252aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RYK (Center) Rabbit Polyclonal Antibody
AP17727PU-N 400 µL

RYK (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NRXN3 Rabbit Polyclonal Antibody
TA379323 100 µL

NRXN3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAAP24 (NM_152266) Human Recombinant Protein
TP305872 20 µg

FAAP24 (NM_152266) Human Recombinant Protein

Sign In for Pricing
View Details
BMP6 Polyclonal Antibody
E-AB-13093-01 20 µL

BMP6 Polyclonal Antibody

Sign In for Pricing
View Details
BMP6 Polyclonal Antibody
E-AB-13093-02 60 µL

BMP6 Polyclonal Antibody

Sign In for Pricing
View Details
BMP6 Polyclonal Antibody
E-AB-13093-03 120 µL

BMP6 Polyclonal Antibody

Sign In for Pricing
View Details