Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1), partial

This Recombinant Human Serine/threonine-protein kinase TBK1 (TBK1), partial spans the amino acid sequence from region 590-729aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NF-kappa-B-activating kinase; T2K; TANK-binding kinase 1

UniProt

Q9UHD2

Expression Region

590-729aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLR1-set siRNA/shRNA/RNAi Lentivector (Human)
33614091 4x 500 ng

OLR1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Collagen I Antibody
ASA-B0469 1 Each

Collagen I Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CYB5R3 Antibody (OTI2A10) [DyLight 405]
NBP2-70572V 0.1 mL

Mouse Monoclonal CYB5R3 Antibody (OTI2A10) [DyLight 405]

Sign In for Pricing
View Details
LINC02693 (NM_001113434) Human Over-expression Lysate
LY426413 100 µg

LINC02693 (NM_001113434) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethyl 3-bromo-4-chloro-5-nitrobenzoate
449076-01 100 mg

Ethyl 3-bromo-4-chloro-5-nitrobenzoate

Sign In for Pricing
View Details
Ethyl 3-bromo-4-chloro-5-nitrobenzoate
449076-02 250 mg

Ethyl 3-bromo-4-chloro-5-nitrobenzoate

Sign In for Pricing
View Details