Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Podocin (NPHS2), Partial

This Recombinant Human Podocin (NPHS2), Partial spans the amino acid sequence from region 124-315aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9NP85

Expression Region

124-315aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CVKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSL-1
C13411-1mg 1 mg

FSL-1

Sign In for Pricing
View Details
Fluo-4, pentasodium salt
TD0049 1 mg

Fluo-4, pentasodium salt

Sign In for Pricing
View Details
Cy3 ethylenediamine
TD0035 1 mg

Cy3 ethylenediamine

Sign In for Pricing
View Details
Anti-Annexin A1 (ANXA1) Mouse Monoclonal Antibody [Clone ID: OTI3A8]
M01451-2 100 µL

Anti-Annexin A1 (ANXA1) Mouse Monoclonal Antibody [Clone ID: OTI3A8]

Sign In for Pricing
View Details
WHI-P180
A8643-10 10 mg

WHI-P180

Sign In for Pricing
View Details
6 well; PET film; 24mm, pore size 8.0μm
XBXS-6-PET-24MM-8μm 6 nests/block, 4 blocks/ctn

6 well; PET film; 24mm, pore size 8.0μm

Sign In for Pricing
View Details