Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse OX-2 membrane glycoprotein (Cd200), partial, Biotinylated

This Recombinant Mouse OX-2 membrane glycoprotein (Cd200), partial, Biotinylated spans the amino acid sequence from region 31-232aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRC OX-2 antigen; CD antigen CD200

UniProt

O54901

Expression Region

31-232aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

70.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F4 Transcription Factor
MBS600890-01 0.25 mL

E2F4 Transcription Factor

Sign In for Pricing
View Details
E2F4 Transcription Factor
MBS600890-02 0.5 mL

E2F4 Transcription Factor

Sign In for Pricing
View Details
E2F4 Transcription Factor
MBS600890-03 5x 0.5 mL

E2F4 Transcription Factor

Sign In for Pricing
View Details
DEPTOR Antibody (N-Term)
orb1925455-01 50 µL

DEPTOR Antibody (N-Term)

Sign In for Pricing
View Details
DEPTOR Antibody (N-Term)
orb1925455-02 100 µL

DEPTOR Antibody (N-Term)

Sign In for Pricing
View Details
Recombinant Human Heat shock protein HSP 90-alpha (HSP90AA1), partial
RPC21474-01 20 µg

Recombinant Human Heat shock protein HSP 90-alpha (HSP90AA1), partial

Sign In for Pricing
View Details