Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein cereblon (CRBN), partial, Biotinylated

This Recombinant Human Protein cereblon (CRBN), partial, Biotinylated spans the amino acid sequence from region 318-426aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q96SW2

Expression Region

318-426aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC23 (NM_001135217) Human Over-expression Lysate
LY427598 100 µg

LRRC23 (NM_001135217) Human Over-expression Lysate

Sign In for Pricing
View Details
LRP5 (C-term) Rabbit Polyclonal Antibody
AP52526PU-N 400 µL

LRP5 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EGFL7 (NM_201446) Human Over-expression Lysate
LC404428 20 µg

EGFL7 (NM_201446) Human Over-expression Lysate

Sign In for Pricing
View Details
Zic4 Mouse Gene Knockout Kit (CRISPR)
KN520086 1 Kit

Zic4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,5-Dichloronitrobenzene
TRC-D435525-50G 50 g

2,5-Dichloronitrobenzene

Sign In for Pricing
View Details
Recombinant Mouse B7-DC/PD-L2/CD273 Protein (Fc Tag)
PKSM041290-01 10 µg

Recombinant Mouse B7-DC/PD-L2/CD273 Protein (Fc Tag)

Sign In for Pricing
View Details