Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein cereblon (CRBN), partial, Biotinylated

This Recombinant Human Protein cereblon (CRBN), partial, Biotinylated spans the amino acid sequence from region 318-426aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q96SW2

Expression Region

318-426aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dpysl3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4806404 1.0 µg DNA

Dpysl3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-CDK4 Antibody (5A439)
TMAC-00793-01 50 μL

Anti-CDK4 Antibody (5A439)

Sign In for Pricing
View Details
Anti-CDK4 Antibody (5A439)
TMAC-00793-02 100 µL

Anti-CDK4 Antibody (5A439)

Sign In for Pricing
View Details
Human Cadherin 17 (CDH17) ELISA Kit
EKN43945 96 Tests

Human Cadherin 17 (CDH17) ELISA Kit

Sign In for Pricing
View Details
Human Phosphoribosyl Pyrophosphate Synthetase 1-Like 1 (PRPS1L1) ELISA Kit
abx382487 96 Tests

Human Phosphoribosyl Pyrophosphate Synthetase 1-Like 1 (PRPS1L1) ELISA Kit

Sign In for Pricing
View Details
Ifi205 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3591307 1.0 µg DNA

Ifi205 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details