Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-crystallin B3 (CRYBB3)

This Recombinant Human Beta-crystallin B3 (CRYBB3) spans the amino acid sequence from region 1-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-B3 crystallin

UniProt

P26998

Expression Region

1-211aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEQHGAPEQAAAGKSHGDLGGSYKVILYELENFQGKRCELSAECPSLTDSLLEKVGSIQVESGPWLAFESRAFRGEQFVLEKGDYPRWDAWSNSRDSDSLLSLRPLNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAINGTWVGYEFPGYRGRQYVFERGEYRHWNEWDASQPQLQSVRRIRDQKWHKRGRFPSS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PSMG3 activation kit by CRISPRa
GA113459 1 Kit

Human PSMG3 activation kit by CRISPRa

Sign In for Pricing
View Details
PD-L1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-22022R-BF555-01 20 µL

PD-L1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
PD-L1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-22022R-BF555-02 100 µL

PD-L1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Rat Sperm-associated antigen 9 (SPAG9) ELISA Kit
MBS9305628-01 48 Well

Rat Sperm-associated antigen 9 (SPAG9) ELISA Kit

Sign In for Pricing
View Details
Rat Sperm-associated antigen 9 (SPAG9) ELISA Kit
MBS9305628-02 96 Well

Rat Sperm-associated antigen 9 (SPAG9) ELISA Kit

Sign In for Pricing
View Details
Rat Sperm-associated antigen 9 (SPAG9) ELISA Kit
MBS9305628-03 5x 96 Well

Rat Sperm-associated antigen 9 (SPAG9) ELISA Kit

Sign In for Pricing
View Details