Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Phospholipase A1 (pldA), partial

This Recombinant Shigella flexneri Phospholipase A1 (pldA), partial spans the amino acid sequence from region 21-52aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Detergent-resistant phospholipase A; DR-phospholipase A; Outer membrane phospholipase A; OM PLA; OMPLA; Phosphatidylcholine 1-acylhydrolase

UniProt

P0A923

Expression Region

21-52aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Shigella flexneri

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEATVKEVHDAPAVRGSIIANMLQEHDNPFTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPS2 Antibody
8C15826-AAT 50 µg

GPS2 Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Galanthus nivalis Lectin (Snowdrop Bulb) -GNA-,  30nm
GP-7401-30 1 mL

Colloidal Gold Conjugated Galanthus nivalis Lectin (Snowdrop Bulb) -GNA-, 30nm

Sign In for Pricing
View Details
Isopropyl 2-Furoate (~90%)
TRC-I824565-500MG 500 mg

Isopropyl 2-Furoate (~90%)

Sign In for Pricing
View Details
H3FT (HIST3H3) Rabbit Polyclonal Antibody
TA377069 100 µL

H3FT (HIST3H3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-[2-(2,2,2-Trifluoroethoxy)phenoxy]-ethanol
TRC-T790195-25G 25 g

2-[2-(2,2,2-Trifluoroethoxy)phenoxy]-ethanol

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS708139 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details