Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 1A, X-chromosomal (EIF1AX)

This Recombinant Human Eukaryotic translation initiation factor 1A, X-chromosomal (EIF1AX) spans the amino acid sequence from region 1-144aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EIF-1A X isoform; Eukaryotic translation initiation factor 4C; eIF-4C

UniProt

P47813

Expression Region

1-144aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytisus scoparius (CSA) (AP)
C9010-87C 1 mg

Cytisus scoparius (CSA) (AP)

Sign In for Pricing
View Details
Human IL-2 ELISPOT antibody pair
CT471-20 20 Plates

Human IL-2 ELISPOT antibody pair

Sign In for Pricing
View Details
MYL9 (NM_006097) Human Tagged Lenti ORF Clone
RC211412L2 10 µg

MYL9 (NM_006097) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LAPTM4B Antibody
orb679225 100 µL

LAPTM4B Antibody

Sign In for Pricing
View Details
Recombinant Human CDH4 Protein, N-His
orb3154948-01 50 µg

Recombinant Human CDH4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CDH4 Protein, N-His
orb3154948-02 100 µg

Recombinant Human CDH4 Protein, N-His

Sign In for Pricing
View Details