Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 1A, X-chromosomal (EIF1AX)

This Recombinant Human Eukaryotic translation initiation factor 1A, X-chromosomal (EIF1AX) spans the amino acid sequence from region 1-144aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EIF-1A X isoform; Eukaryotic translation initiation factor 4C; eIF-4C

UniProt

P47813

Expression Region

1-144aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sbp Mouse shRNA Plasmid (Locus ID 20234)
TL512179 1 Kit

Sbp Mouse shRNA Plasmid (Locus ID 20234)

Sign In for Pricing
View Details
RSPO1 Rabbit pAb, Pacific Blue conjugated
orb2844669 100 µL

RSPO1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Mouse CD117 (c-Kit) Rat mAb, Pacific Blue conjugated
orb2828082-01 25 Tests

Mouse CD117 (c-Kit) Rat mAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Mouse CD117 (c-Kit) Rat mAb, Pacific Blue conjugated
orb2828082-02 50 Tests

Mouse CD117 (c-Kit) Rat mAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Mouse CD117 (c-Kit) Rat mAb, Pacific Blue conjugated
orb2828082-03 100 Tests

Mouse CD117 (c-Kit) Rat mAb, Pacific Blue conjugated

Sign In for Pricing
View Details
4- (Naphthalen-2-yl) butanoic acid
OR303161-01 500 mg

4- (Naphthalen-2-yl) butanoic acid

Sign In for Pricing
View Details