Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Small proline-rich protein 4 (Sprr4)

This Recombinant Mouse Small proline-rich protein 4 (Sprr4) spans the amino acid sequence from region 1-76aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8CGN8

Expression Region

1-76aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSHQHQNQQQCTPQAQQQQVKQPCQPPPTKCQEACVPKTKDPCVPQAKKQCPARSTTNPAQEKCPAQQDPKCKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Intergrin Alpha 5/CD49E ELISA Kit PicoKine®, Carrier-free
EK2227-carrier-free 96 Well With Removable Strips

Human Intergrin Alpha 5/CD49E ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
Anti-PIP4K2B Antibody Picoband® Fluoro488 Conjugated
A09390-2-Fluoro488 100 µg/Vial

Anti-PIP4K2B Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Human Galanin (GAL) ELISA Kit
RK01435 96 Tests

Human Galanin (GAL) ELISA Kit

Sign In for Pricing
View Details
Tert-butyl 4-bromo-2-isopropylbenzoate
OR1089238-01 250 mg

Tert-butyl 4-bromo-2-isopropylbenzoate

Sign In for Pricing
View Details
Tert-butyl 4-bromo-2-isopropylbenzoate
OR1089238-02 500 mg

Tert-butyl 4-bromo-2-isopropylbenzoate

Sign In for Pricing
View Details
Tert-butyl 4-bromo-2-isopropylbenzoate
OR1089238-03 1 g

Tert-butyl 4-bromo-2-isopropylbenzoate

Sign In for Pricing
View Details