Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Fibroblast growth factor (FGF2), Partial

Recombinant Pig Fibroblast growth factor (FGF2), Partial

Product Specifications

UniProt

A0A287BGK8

Expression Region

1-165aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cardiovascular Research; Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSRSGRPRGRPQKTGASRGRRAGREEGRGRGGWWAFGGGDVEDVTPRGSAGARPADSEPAVASRSRALQFGEAALPRVAAAEKPSPNPQLQGRRRAKRPNSTRLGARGRGRVPRGGRLGGRGRGRAPERVGGRGRGSAAAAAAAPRAAPGARGPRQSPGGAMAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKIA siRNA (Rat)
MBS8229994-01 15 nmol

PKIA siRNA (Rat)

Sign In for Pricing
View Details
PKIA siRNA (Rat)
MBS8229994-02 30 nmol

PKIA siRNA (Rat)

Sign In for Pricing
View Details
PKIA siRNA (Rat)
MBS8229994-03 5x 30 nmol

PKIA siRNA (Rat)

Sign In for Pricing
View Details
Monkey GPR120 (G Protein Coupled Receptor 120) ELISA Kit
MBS2509714-01 24 Tests

Monkey GPR120 (G Protein Coupled Receptor 120) ELISA Kit

Sign In for Pricing
View Details
Monkey GPR120 (G Protein Coupled Receptor 120) ELISA Kit
MBS2509714-02 48 Tests

Monkey GPR120 (G Protein Coupled Receptor 120) ELISA Kit

Sign In for Pricing
View Details
Monkey GPR120 (G Protein Coupled Receptor 120) ELISA Kit
MBS2509714-03 96 Tests

Monkey GPR120 (G Protein Coupled Receptor 120) ELISA Kit

Sign In for Pricing
View Details