Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Platelet-derived growth factor subunit B (PDGFB)

This Recombinant Sheep Platelet-derived growth factor subunit B (PDGFB) spans the amino acid sequence from region 82-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PDGF subunit B; PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide

UniProt

Q95229

Expression Region

82-190aa

Tag

N-terminal 6xHis-TrxA-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLGSPTVAEPAVIAECKTRTEVSEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQDRKVQVKKIEIVRKKKIFKKATVTLVDHLACRCETVMARAVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-IBV NP Monoclonal antibody, clone 4H7
DMAB-CS23042 100 μg, 1 mg

Rabbit Anti-IBV NP Monoclonal antibody, clone 4H7

Sign In for Pricing
View Details
Human HSP70 Recombinant Protein
PROTP0DMV8-20ug 20 µg

Human HSP70 Recombinant Protein

Sign In for Pricing
View Details
DUSP23 ORF Vector (Human) (pORF)
ORF003321 1.0 µg DNA

DUSP23 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human anti-human IL-6 mAb (1H4C)
E409C15-h4C100 100 µg

Human anti-human IL-6 mAb (1H4C)

Sign In for Pricing
View Details
1,3-Dimethyl 2- (2-bromopropan-2-yl) propanedioate
DXC58763-01 50 mg

1,3-Dimethyl 2- (2-bromopropan-2-yl) propanedioate

Sign In for Pricing
View Details
1,3-Dimethyl 2- (2-bromopropan-2-yl) propanedioate
DXC58763-02 0.5 g

1,3-Dimethyl 2- (2-bromopropan-2-yl) propanedioate

Sign In for Pricing
View Details